Buy IGF-1 DES Peptides | Order IGF-1 DES 1MG

Buy IGF-1 DES Peptides

$85.00

59 in stock

Category:

IGF-DES has a functionality relating to hyperplasia, or the enlargement of an organ or tissue caused by the increase of cell creation. When created naturally, IGF-DES is created by the liver. In the synthetic variation, the last three bonds are removed making it easier for the peptide to bind to lactic acid receptors increasing its overall potency as a peptide.

Application: Analogue of insulin-like growth factor 1
CAS: 112603-35-7
Molecular Weight: 7371.4 g·mol
Chemical Formula: C319H501N91O96S7
Chemical Name: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Synonyms: IGF1 Human Des1-3; Insulin-Like Growth Factor 1 Des
Storage: Minimize open air exposure, store in a cool dry place.
Stability: 2 years
Purity: >97%
Solubility: Soluble to water at rate of 1 mg/mL
Physical Form: fine powder in glass vial
Specifications: 1mg vial
Terms: The products we offer are intended for laboratory research use only. You will need to purchase

Bacteriostatic water separately.

At Paradigm Peptides, our IGF DES peptide is of the highest authenticity and purity. Paradigm Peptides is your leading provider for all pharma-grade peptides.

The IGF-DES structure is made up of 70 amino acids when created naturally, when created this way its lifespan is relatively short. However, when created synthetically, the last three bonds are removed to increase the lifespan of the peptide, making it 67 amino acids instead of 70.

Hippocampus Study in Rat Model

Delving into the intricate realm of diabetic complications, a rat-based investigation explored the impact of IGF 1 DES treatment amidst streptozotocin (STZ)-induced diabetes. Male rats were meticulously categorized into non-diabetic (ND), diabetic with subcutaneous osmotic minipumps releasing vehicle (STZ-veh), or diabetic with pumps releasing IGF 1 DES (STZ-des) for 2 weeks. Subsequent euthanization facilitated comprehensive analyses of retinal tissues.

While IGF 1 DES treatment didn’t mitigate hyperglycemia or weight loss in diabetic rats, it notably curbed the surge of type 1 IGF receptor immunoreactivity, which otherwise escalated in STZ-veh rats. This normalization was evident in the ganglion cell layer (GCL) and inner nuclear layer (INL) of the retina. Moreover, IGF 1 DES treatment exhibited promising indications of mitigating vascular endothelial growth factor (VEGF) immunoreactivity in retinal pigmented epithelial cells (RPEs), diverging from STZ-veh rats. [4]

Furthermore, the treatment regimen manifested a reduction in phospho-Akt (Thr 308) immunoreactivity, an apoptotic-stress response protein, aligning with non-diabetic levels. These compelling findings hint at the therapeutic potential of IGF 1 DES in mitigating retinal changes associated with STZ-induced diabetes in rats. [4]

Rat Study on Effects of IGF Variations on Growth Hormone and IGF Binding Protein Secretion

Intriguing insights emerged from a rat-centric exploration into the effects of insulin-like growth factor-I (IGF-I), IGF-II, and IGF 1 DES on the secretion dynamics of growth hormone (GH) and insulin-like growth factor-binding protein (IGFBP) from cultured rat anterior pituitary cells. Notably, IGF-I and IGF 1 DES demonstrated dual roles in GH secretion, with stimulatory effects at low concentrations and inhibitory actions at higher doses. Remarkably, IGF 1 DES exhibited heightened potency compared to IGF-I, attributed to reduced binding by pituitary IGFBP. [5]

Conversely, IGF-II showcased distinct characteristics, inhibiting GH secretion at higher concentrations. The study unraveled nuances in IGFBP binding patterns, underscoring the complex interplay between IGF variants and pituitary dynamics.

Mouse Skeletal and Cardiac Muscle Study of the Differential Effects of IGF 1 DES on ERKs, AKT-1 and P70 S6K activation

Diving deeper into molecular intricacies, a mouse-based inquiry dissected alterations in phosphorylation levels of ERK1/2, Akt-1, and p70 S6K post intraperitoneal injection of IGF 1 DES. Notably, IGF 1 DES wielded differential effects across skeletal and cardiac muscles, notably enhancing Akt-1 phosphorylation without impacting p44 and p42 MAP kinases. [6]

Furthermore, IGF 1 DES exhibited muscle-specific variations in p70 S6K phosphorylation and influenced FKHR phosphorylation in cardiac muscle. While insulin and IGF-I levels remained unaffected, IGF 1 DES demonstrated a significant reduction in plasma glucose levels, unveiling its distinct impact on glucose homeostasis. These discerning findings shed light on the divergent pathways modulated by IGF 1 DES across skeletal and cardiac muscle tissues, unraveling novel avenues for therapeutic exploration. [6]

IGF DES 1mg at Paradigm Peptides
Paradigm Peptides is your leading provider for all premium-grade peptides, SARMS, and research chemicals. Have questions, we have answers, feel free to contact us with all your peptide, SARMs, or research chemical related inquiries.

Research:

[1] https://www.sciencedirect.com/science/article/abs/pii/1357272596000568?via%3Dihub

[2] https://joe.bioscientifica.com/view/journals/joe/146/1/joe_146_1_018.xml

[3] https://joe.bioscientifica.com/view/journals/joe/127/3/joe_127_3_005.xml

[4] https://journals.physiology.org/doi/full/10.1152/jn.00768.2004

[5] https://joe.bioscientifica.com/view/journals/joe/130/1/joe_130_1_012.xml

[6] https://link.springer.com/article/10.1023/A:1016164601887

Disclaimer: The IGF-DES currently listed on this site is sold for research use only. Not for human consumption. This product is not a drug, supplement, food or cosmetic and it may not be misused, sold, labeled or branded as such.

Weight .25 oz
Dimensions 1 × 1 × 1 in