Buy IGF-1 DES Peptides
$85.00
94 in stock
IGF-DES has a functionality relating to hyperplasia, or the enlargement of an organ or tissue caused by the increase of cell creation. Two of it’s main functionalities include initiate cellular repair and quicker wound healing. In most situations, according to researchers, those that use IGF-DES will notice an increase of muscle growth at the injection site. When created by the body, IGF-DES is created by the liver. In the synthetic variation, the last three bonds are removed making it easier for the peptide to bind to lactic acid receptors increasing its overall potency as a peptide.
Application: | Analogue of insulin-like growth factor 1 |
CAS: | 112603-35-7 |
Molecular Weight: | 7371.4 g·mol |
Chemical Formula: | C319H501N91O96S7 |
Chemical Name: | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Synonyms: | IGF1 Human Des1-3; Insulin-Like Growth Factor 1 Des |
Storage: | Minimize open air exposure, store in a cool dry place. |
Stability: | 2 years |
Purity: | >97% |
Solubility: | Soluble to water at rate of 1 mg/mL |
Physical Form: | fine powder in glass vial |
Specifications: | 1mg vial |
Terms: | The products we offer are intended for laboratory research use only. You will need to purchase
Bacteriostatic water separately. |
At Paradigm Peptides, our IGF DES peptide is of the highest authenticity and purity and is available in 1mg vials. Paradigm Peptides is your leading provider for all pharma-grade peptides
IGF DES has a functionality relating to hyperplasia, or the enlargement of an organ or tissue caused by the increase of cell creation. The synthetic version of this peptide can initiate cellular repair and quicker wound healing in addition to many other benefits. A nice addition to this peptide working when and where it should be is its ability to increase muscle growth at the injection site and the development of lean muscle mass. IGF DES is typically produced naturally in the liver but can be created in various tissues throughout the body. Its structure is made up of 70 amino acids when created naturally, when created this way its lifespan is relatively short.
However, when created synthetically, the last three bonds are removed to increase the lifespan of the peptide, making it 67 amino acids instead of 70. By creating this synthetic version of the peptide, it allows it to bind to lactic acid receptors which increases its overall potency. When it comes to dosages, it is not recommended to exceed 40 to 50mcg a day for men and no more than 20mcg for women daily.
The effects of taking IGF-DES typically will take a couple of weeks to see. If looking for a full effect it is said to take about three to six months before these results can be seen. The results of taking IGF DES will also depend upon external factors such as age, weight, and health history.
Adverse Side Effects
- Acne
- Nausea
- Pain or swelling at the injection site
- Redness or irritation at the injection site
IGF DES 1mg at Paradigm Peptides
At Paradigm Peptides, our IGF DES peptide is of the highest authenticity and purity and is available in 1mg vials. Paradigm Peptides is your leading provider for all premium-grade peptides, SARMS, and research chemicals. Have questions, we have answers, feel free to contact us with all your peptide, SARMs, or research chemical related inquiries
Research:
- https://www.sciencedirect.com/science/article/abs/pii/1357272596000568?via%3Dihub
- https://joe.bioscientifica.com/view/journals/joe/146/1/joe_146_1_018.xml
- https://joe.bioscientifica.com/view/journals/joe/127/3/joe_127_3_005.xml
Disclaimer: The IGF-DES currently listed on this site is sold for research use only. Not for human consumption. This product is not a drug, supplement, food or cosmetic and it may not be misused, sold, labeled or branded as such.
Weight | .25 oz |
---|---|
Dimensions | 1 × 1 × 1 in |